PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PGSC0003DMP400039437
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum
Family MIKC_MADS
Protein Properties Length: 197aa    MW: 22504.8 Da    PI: 9.4644
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PGSC0003DMP400039437genomePGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF94.93.5e-30959151
                          S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
                SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                          krien + rqvtfskRr g+lKKA+ELSvLCdaeva+i+fs++gklye+ss
  PGSC0003DMP400039437  9 KRIENATSRQVTFSKRRSGLLKKAFELSVLCDAEVALIVFSPKGKLYEFSS 59
                          79***********************************************96 PP

2K-box547.2e-19861671192
                 K-box  11 eakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenk 92 
                           + ++e+l++e+a + +++e L+ ++R+llG +Les +l eLqq+e+qLeksl++iR++K e+l   +    + ek+++++ +
  PGSC0003DMP400039437  86 QLTTEHLKEEVATMTRKLEFLEDSKRKLLGHGLESSTLDELQQVEEQLEKSLSNIRARKCEVLPLTLTPFPQVEKDVERQIM 167
                           55789*********************************************************98888888888887777655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004327.1E-41160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006631.735161IPR002100Transcription factor, MADS-box
SuperFamilySSF554552.22E-32373IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
CDDcd002656.98E-43375No hitNo description
PRINTSPR004047.2E-31323IPR002100Transcription factor, MADS-box
PfamPF003195.4E-271057IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-312338IPR002100Transcription factor, MADS-box
PRINTSPR004047.2E-313859IPR002100Transcription factor, MADS-box
PfamPF014865.0E-1688165IPR002487Transcription factor, K-box
PROSITE profilePS5129710.30289184IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010048Biological Processvernalization response
GO:0048510Biological Processregulation of timing of transition from vegetative to reproductive phase
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 197 aa     Download sequence    Send to blast
MVRGKTELKR IENATSRQVT FSKRRSGLLK KAFELSVLCD AEVALIVFSP KGKLYEFSSS  60
STTKTIERYQ KNDKSLGRLN RKLTDQLTTE HLKEEVATMT RKLEFLEDSK RKLLGHGLES  120
STLDELQQVE EQLEKSLSNI RARKCEVLPL TLTPFPQVEK DVERQIMEVE TELFIGRPET  180
RKNSYCPNLN TPPTSL*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3kov_A4e-18387287Myocyte-specific enhancer factor 2A
3kov_B4e-18387287Myocyte-specific enhancer factor 2A
3kov_I4e-18387287Myocyte-specific enhancer factor 2A
3kov_J4e-18387287Myocyte-specific enhancer factor 2A
3mu6_A4e-18369268Myocyte-specific enhancer factor 2A
3mu6_B4e-18369268Myocyte-specific enhancer factor 2A
3mu6_C4e-18369268Myocyte-specific enhancer factor 2A
3mu6_D4e-18369268Myocyte-specific enhancer factor 2A
3p57_A4e-18387287Myocyte-specific enhancer factor 2A
3p57_B4e-18387287Myocyte-specific enhancer factor 2A
3p57_C4e-18387287Myocyte-specific enhancer factor 2A
3p57_D4e-18387287Myocyte-specific enhancer factor 2A
3p57_I4e-18387287Myocyte-specific enhancer factor 2A
3p57_J4e-18387287Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2441958e-92AC244195.1 Solanum lycopersicum strain Heinz 1706 chromosome 8 clone hba-6a9 map 8, complete sequence.
GenBankHG9754478e-92HG975447.1 Solanum pennellii chromosome ch08, complete genome.
GenBankHG9755208e-92HG975520.1 Solanum lycopersicum chromosome ch08, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006358849.11e-134PREDICTED: agamous-like MADS-box protein AGL19
SwissprotO827433e-63AGL19_ARATH; Agamous-like MADS-box protein AGL19
TrEMBLM1C2V61e-140M1C2V6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000585601e-134(Solanum tuberosum)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G22950.18e-57AGAMOUS-like 19
Publications ? help Back to Top
  1. Xu X, et al.
    Genome sequence and analysis of the tuber crop potato.
    Nature, 2011. 475(7355): p. 189-95
    [PMID:21743474]